Xigmatek - Agora no Brasil!

1.67 Rating by ClearWebStats
This website has a #873,408 rank in global traffic. It has a .com.br as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, xigmatek.com.br is SAFE to browse.
Get Custom Widget

Traffic Report of Xigmatek

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 5

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 873,408
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
60
Siteadvisor Rating
View xigmatek.com.br site advisor rating Not Applicable

Where is xigmatek.com.br server located?

Hosted IP Address:

186.202.153.128 View other site hosted with xigmatek.com.br

Hosted Country:

xigmatek.com.br hosted country BR xigmatek.com.br hosted country

Location Latitude:

-22.8305

Location Longitude:

-43.2192

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View xigmatek.com.br HTML resources

Homepage Links Analysis

Xigmatek - Agora no Brasil!

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 5 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 46
Google Adsense: Not Applicable Google Analytics: UA-52349966-1

Websites Hosted on Same IP (i.e. 186.202.153.128)

Jornal O NORTÃO

xigmatek.com.br favicon - onortao.com.br

View xigmatek.com.br Pagerank   xigmatek.com.br alexa rank 564,689   xigmatek.com.br website value $ 1,200.00

Home - Forma de Pudim

xigmatek.com.br favicon - formadepudim.com.br

View xigmatek.com.br Pagerank   xigmatek.com.br alexa rank 1,603,689   xigmatek.com.br website value $ 480.00


Kernel Distribuidora

xigmatek.com.br favicon - kernel.com.br

View xigmatek.com.br Pagerank   xigmatek.com.br alexa rank 735,361   xigmatek.com.br website value $ 960.00

Locaweb HTTP Server

xigmatek.com.br favicon - durapetsgreenusa.com

View xigmatek.com.br Pagerank   xigmatek.com.br alexa rank Not Applicable   xigmatek.com.br website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 22 Nov 2014 14:24:37 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Length: 37395
Connection: close
Content-Type: text/html; charset=utf-8

Domain Nameserver Information

Host IP Address Country
ns2.locaweb.com.br xigmatek.com.br name server information 187.45.248.254 xigmatek.com.br server is located in Brazil Brazil
ns3.locaweb.com.br xigmatek.com.br name server information 189.126.101.254 xigmatek.com.br server is located in Brazil Brazil
ns1.locaweb.com.br xigmatek.com.br name server information 186.202.8.254 xigmatek.com.br server is located in Brazil Brazil

DNS Record Analysis

Host Type TTL Extra
xigmatek.com.br A 3599 IP:186.202.153.128
xigmatek.com.br NS 3598 Target:ns2.locaweb.com.br
xigmatek.com.br NS 3598 Target:ns3.locaweb.com.br
xigmatek.com.br NS 3598 Target:ns1.locaweb.com.br
xigmatek.com.br SOA 3599 MNAME:ns1.locaweb.com.br
RNAME:postmaster.locaweb.com.br
Serial:2013101501
Refresh:3600
Retry:600
Expire:1209600
xigmatek.com.br MX 3599 Priority:20
Target:mx.jk.locaweb.com.br
xigmatek.com.br MX 3599 Priority:10
Target:mx.core.locaweb.com.br
xigmatek.com.br MX 3599 Priority:10
Target:mx.b.locaweb.com.br
xigmatek.com.br MX 3599 Priority:20
Target:mx.a.locaweb.com.br
xigmatek.com.br TXT 3599 TXT:v=spf1 include:_spf.locaweb.com.br ?all

Similarly Ranked Websites to Xigmatek

АУРА СТУДИЯ

xigmatek.com.br favicon - aurastudia.ru

РђРЈР Рђ РЎРўРЈР”Р

View xigmatek.com.br Pagerank   Alexa rank for xigmatek.com.br 873,409   website value of xigmatek.com.br $ 720.00

«Ай молодец, радиомастер!» - сайт для радиолюбителя. Новости в мире электроники, проектирование в AutoCad Electrical, принципиальные схемы

xigmatek.com.br favicon - imolodec.com

«Ай молодец, радиомастер!» - сайт, посвященный радиоэлектронике. Мы рассматриваем вопросы проектирования и разработки электронных устройств. Предлагаем профессиональные уроки и практические материалы для изучения AutoCad Electrical

View xigmatek.com.br Pagerank   Alexa rank for xigmatek.com.br 873,409   website value of xigmatek.com.br $ 720.00

Kiev Apartments - Rent Kiev Apartment in Ukraine

xigmatek.com.br favicon - kievapts.com

If you need Kiev Apartments, Rent Kiev Apartment, Kiev Ukraine Apartments you've found the right place! American owned company.

View xigmatek.com.br Pagerank   Alexa rank for xigmatek.com.br 873,410   website value of xigmatek.com.br $ 720.00

Ankara Evden Eve Nakliyat Rehberi - Bölgelere Göre Ankara Nakliye Firmaları

xigmatek.com.br favicon - ankaraevdenevenakliyatfirmalari.com

Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.

View xigmatek.com.br Pagerank   Alexa rank for xigmatek.com.br 873,410   website value of xigmatek.com.br $ 720.00

KOSGEB Girişimcilik Destek Programı - Girişimcilik Desteği

xigmatek.com.br favicon - girisimcilikdestegi.com

View xigmatek.com.br Pagerank   Alexa rank for xigmatek.com.br 873,410   website value of xigmatek.com.br $ 720.00